PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G219400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 361aa    MW: 40295 Da    PI: 6.3894
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G219400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.76.5e-191461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT+eEd+ lvd++k++G g+W++ ++  g++R++k+c++rw +yl
  Aqcoe3G219400.1.p 14 KGPWTPEEDDMLVDYIKRHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 61
                       79********************************************97 PP

2Myb_DNA-binding569.2e-1867112148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        rg++++eE++l++ ++  lG++ W+ Ia +++ gRt++++k++w+++l
  Aqcoe3G219400.1.p  67 RGKFSEEEEQLIISLHSVLGNK-WSQIATHLP-GRTDNEIKNYWNTHL 112
                        89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-25564IPR009057Homeodomain-like
PROSITE profilePS5129417.666961IPR017930Myb domain
SuperFamilySSF466891.5E-3211108IPR009057Homeodomain-like
SMARTSM007172.5E-151363IPR001005SANT/Myb domain
PfamPF002493.5E-171461IPR001005SANT/Myb domain
CDDcd001678.81E-121661No hitNo description
PROSITE profilePS5129428.96362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.2E-2865116IPR009057Homeodomain-like
SMARTSM007171.9E-1766114IPR001005SANT/Myb domain
PfamPF002491.3E-1667112IPR001005SANT/Myb domain
CDDcd001678.45E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MGRSPCCDEF GLKKGPWTPE EDDMLVDYIK RHGHGSWRAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SEEEEQLIIS LHSVLGNKWS QIATHLPGRT DNEIKNYWNT HLKKKLLQMG  120
IDPITHRPRT DLNLLANLPH LLAAANLSNL MNPWDNALRL QADAAQLAKI QLLHSLTQVL  180
NTSTAPPNMD LLNQLGSAPV QDYLLNEYLR SNSQFDGLAN GHHPLGLNVT DPNQNLSSFS  240
NLVAQQPNHE YQAMANTFSR LEGEPNSNMS NIDNYHLSSS SHSIASANTI PALVSASPES  300
SIVNQTESKV NPNDIISTHS STSTTLEAWF NLDDEANNDY YWKELLLDQT TSPSSWPISQ  360
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-30121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003634006.11e-146PREDICTED: transcription factor MYB39
TrEMBLF6HEE41e-146F6HEE4_VITVI; Putative uncharacterized protein
STRINGVIT_16s0039g01710.t011e-146(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02940.14e-86myb domain protein 107